Ziel
"The project aims to elucidate the character of Roman expansionism and Roman urbanism in the Middle Republic through an analysis of how the Roman conquest affected the physical development of pre-existing urban centres on the Italian peninsula. This will be achieved through the creation of a Geographic Information System (GIS) database of peninsular urban centres that existed between 338 and 150 BC. Structured chronologically, each settlement in the database will be given attributes representing information on their physical development during this period. A series of research questions will be used in an interrogation of the completed database, looking for patterns that might represent the effects of the Roman conquest.
Methods applied in small-scale landscape studies (GIS) will be adapted on a much larger scale. Peninsular Italy will be the landscape, populated with known walled centres. The Fellow’s extensive research experience in Roman urbanism of the period in question will be augmented through the acquisition of new computer-based analytical skills. The results of the study will be relevant for the numerous research projects concerned with regional landscapes and individual urban sites in Italy, as well as for scholars interested in broader historical processes connected with Roman expansionism during the period. Once the results are published, the GIS data will be placed in the public domain so that they may be utilised by other scholars in the ERA and beyond who are working on related themes."
Wissenschaftliches Gebiet (EuroSciVoc)
CORDIS klassifiziert Projekte mit EuroSciVoc, einer mehrsprachigen Taxonomie der Wissenschaftsbereiche, durch einen halbautomatischen Prozess, der auf Verfahren der Verarbeitung natürlicher Sprache beruht. Siehe: https://op.europa.eu/en/web/eu-vocabularies/euroscivoc.
CORDIS klassifiziert Projekte mit EuroSciVoc, einer mehrsprachigen Taxonomie der Wissenschaftsbereiche, durch einen halbautomatischen Prozess, der auf Verfahren der Verarbeitung natürlicher Sprache beruht. Siehe: https://op.europa.eu/en/web/eu-vocabularies/euroscivoc.
- NaturwissenschaftenInformatik und InformationswissenschaftenDatenbank
- NaturwissenschaftenGeowissenschaften und verwandte Umweltwissenschaftenphysikalische GeographieKartografiegeografische Informationssysteme
- SozialwissenschaftenPolitikissenschaftRegierungssystem
Sie müssen sich anmelden oder registrieren, um diese Funktion zu nutzen
Wir bitten um Entschuldigung ... während der Ausführung ist ein unerwarteter Fehler aufgetreten.
Sie müssen sich authentifizieren. Ihre Sitzung ist möglicherweise abgelaufen.
Vielen Dank für Ihr Feedback. Sie erhalten in Kürze eine E-Mail zur Übermittlungsbestätigung. Wenn Sie sich für eine Benachrichtigung über den Berichtsstatus entschieden haben, werden Sie auch im Falle einer Änderung des Berichtsstatus benachrichtigt.
Thema/Themen
Aufforderung zur Vorschlagseinreichung
FP7-PEOPLE-2011-IEF
Andere Projekte für diesen Aufruf anzeigen
Finanzierungsplan
MC-IEF -Koordinator
DH1 3LE Durham
Vereinigtes Königreich