Projektbeschreibung
Internetrouten für die Geopolitik kartieren
Am 30. Mai 2022 fiel das Internet in der Stadt Cherson aus, als russische Truppen mit vorgehaltener Waffe die örtlichen Betreiber zwangen, die Verbindung zum ukrainischen Netz zu unterbrechen und die Verbindung über Moskau wiederherzustellen. Für Russland, wie für viele andere Länder auch, hat sich die Kontrolle der Internetrouten zur Informationskontrolle zu einer strategischen Priorität entwickelt. Diese Strategien nehmen Einfluss auf den Cyberspace, der entlang nationaler Grenzen fragmentiert ist, sich aber auch um einige große Routing-Betreiber und -Plattformen zusammenzieht, die von Leistungs- und Marktkräften in einer Weise angetrieben werden, die weitgehend unsichtbar bleibt, aber aufgedeckt werden kann. Das ERC-finanzierte Projekt DATAROUTES bietet neue Methoden auf der Grundlage von frei zugänglichen Daten und Feldforschung, um eine Kartographie der Internetrouten zu erstellen und zu untersuchen, wie und mit welchen Folgen sie für die geopolitische Kontrolle genutzt werden können.
Ziel
The Internet has been able to grow and develop very quickly in most countries because of its highly decentralized nature. Its resilience is based on a multiplicity of different paths that allow data to always bypass a blockage or a partial destruction of the network through alternative routes. This model is today called into question by a combination of dynamics. First, we observe a dynamic of fragmentation along national borders, at the initiative of some states who, in the name of national security, seek to restore control over the borders of what they see as their national cyberspace. Second, at a higher level of abstraction, we observe another dynamic, this time guided by market forces: the concentration of data traffic around a few major players in data routing and a few large platforms. Largely invisible, this concentration also leads to a form of fragmentation along commercial lines. These evolutions raise important issues in terms of cyber stability, resilience, free flow of data and human rights, that are largely overlooked short of scientific knowledge about the geopolitics of Internet data routes.
DATAROUTES aims to carry out a cartography of Internet data routes in order to understand how the routing strategies of state and non-state actors shape cyberspace and to analyze, as a domain of application, the important security and policy issues it raises for the European Union. The goals of this project are to measure and map Internet routes using open source data, thanks to DATAROUTES’ Border Gateway Protocol observatory; investigate through field work the strategic goals of state and non-state actors uncovered by the cartography; and analyze the broader policy issues they raise for the European Union in the context of the implementation of the 2020 Cybersecurity Strategy for a Digital Decade. DATROUTES will provide a platform for open access to its data and methodologies in order to encourage a new stream of research on the geopolitics of data routing.
Wissenschaftliches Gebiet (EuroSciVoc)
CORDIS klassifiziert Projekte mit EuroSciVoc, einer mehrsprachigen Taxonomie der Wissenschaftsbereiche, durch einen halbautomatischen Prozess, der auf Verfahren der Verarbeitung natürlicher Sprache beruht. Siehe: https://op.europa.eu/en/web/eu-vocabularies/euroscivoc.
CORDIS klassifiziert Projekte mit EuroSciVoc, einer mehrsprachigen Taxonomie der Wissenschaftsbereiche, durch einen halbautomatischen Prozess, der auf Verfahren der Verarbeitung natürlicher Sprache beruht. Siehe: https://op.europa.eu/en/web/eu-vocabularies/euroscivoc.
- NaturwissenschaftenInformatik und InformationswissenschaftenInternet
- NaturwissenschaftenGeowissenschaften und verwandte Umweltwissenschaftenphysikalische GeographieKartografie
- NaturwissenschaftenInformatik und InformationswissenschaftenComputersicherheit
Sie müssen sich anmelden oder registrieren, um diese Funktion zu nutzen
Schlüsselbegriffe
Programm/Programme
- HORIZON.1.1 - European Research Council (ERC) Main Programme
Thema/Themen
Aufforderung zur Vorschlagseinreichung
(öffnet in neuem Fenster) ERC-2022-ADG
Andere Projekte für diesen Aufruf anzeigenFinanzierungsplan
HORIZON-ERC - HORIZON ERC GrantsGastgebende Einrichtung
93526 Saint-Denis
Frankreich